Multiwell RepliTope(TM) Human (TCRgamma alternate reading frame protein TARP)

Dodavatel: JPT Peptide Technologies
Katalogové číslo: RT-MW-TARP
Velikost balení: 1 peptide microarray (each peptide is deposited 3x per subarray, 21 subarrays per slide)
Cena: NA VYŽÁDÁNÍ
Dostupnost: NA OBJEDNÁNÍ
Multiwell RepliTope(TM) Human (TCRgamma alternate reading frame protein TARP)
Peptide microarray displaying 12 peptides derived from a peptide scan through TCRgamma alternate reading frame protein of Homo sapiens (Human). Incubation with 20 samples (and one control) in parallel using the Array Slide 24-4 chamber. Protein name: TCRgamma alternate reading frame protein. Specification: Peptide scan (15mers with 11 aa overlap). UniProt-ID: A2JGV3. Sequence: MQMFPPSPLFFFLQLLKQSSRRLEHTFVFLRNFSLMLLRYIGKKRRATRFWDPRRGTP. Protein Length: 58
1
RT-MW-TARP