Multiwell RepliTope(TM) Human (TCRgamma alternate reading frame protein TARP)
Peptide microarray displaying 12 peptides derived from a peptide scan through TCRgamma alternate reading frame protein of Homo sapiens (Human). Incubation with 20 samples (and one control) in parallel using the Array Slide 24-4 chamber. Protein name: TCRgamma alternate reading frame protein. Specification: Peptide scan (15mers with 11 aa overlap). UniProt-ID: A2JGV3. Sequence: MQMFPPSPLFFFLQLLKQSSRRLEHTFVFLRNFSLMLLRYIGKKRRATRFWDPRRGTP. Protein Length: 58