Multiwell RepliTope(TM) Human (NY-ESO-1)
Peptide microarray displaying 44 peptides derived from a peptide scan through Cancer/testis antigen 1 (NY-ESO-1) of Homo sapiens (Human). Incubation with 20 samples (and one control) in parallel using the Array Slide 24-4 chamber. Protein name: Cancer/testis antigen 1 (NY-ESO-1). Specification: Peptide scan (15mers with 11 aa overlap). UniProt-ID: P78358. Sequence: MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR. Protein Length: 180