We value your privacy

We and our digital partners use cookies on this website. Some of them are necessary for the functionality of the website, but you can decide on the following cookies yourself.

Settings

Accept all

Necessary/functional

It would not be possible to operate the website without these cookies. They include, for example, cookies for storing selected settings or remembering logins.

Always active

Analytics

These cookies are used to measure and analyze traffic to our website (number of visitors, pages viewed, average browsing time, etc.). By consent, you will allow us to obtain data on how you use our site.

RepliTope(TM) SARS (E protein)

Dodavatel:	JPT Peptide Technologies
Katalogové číslo:	RT-0034
Velikost balení:	1 peptide microarray (each peptide is deposited 3x per subarray, 4 subarrays per slide) + dummy slide and spacers (needed for manual incubation)
Cena:	NA VYŽÁDÁNÍ
Dostupnost:	NA OBJEDNÁNÍ

RepliTope(TM) SARS (E protein)

Peptide microarray displaying 17 peptides derived from a peptide scan through E protein of SARS coronavirus urbani. Protein name: E protein. Specification: Peptide scan (15mers with 11 aa overlap). UniProt-ID: P59637. Sequence: MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV. Protein Length: 76

We value your privacy

Necessary/functional

Analytics

Advertisement

RepliTope(TM) SARS (E protein)

Související produkty + doporučené příslušenství