Multiwell RepliTope(TM) HCMVA (UL99)

Peptide microarray displaying 45 peptides derived from a peptide scan through Tegument protein UL99 of Human cytomegalovirus (HHV-5). Incubation with 20 samples (and one control) in parallel using the Array Slide 24-4 chamber. Protein name: Tegument protein. Specification: Peptide scan (15mers with 11 aa overlap). UniProt-ID: P13200. Sequence: MGAELCKRICCEFGTTPGEPLKDALGRQVSLRSYDNIPPTSSSDEGEDDDDGEDDDNEERQQKLRLCGSGCGGNDSSSGSHREATHDGSKKNAVRSTFREDKAPKPSKQSKKKKKPSKHHHHQQSSIMQETDDLDEEDTSIYLSPPPVPPVQVVAKRLPRPDTPRTPRQKKISQRPPTPGTKKPAASLPF. Protein Length: 190