Multiwell RepliTope(TM) BKV (small T antigen)
Peptide microarray displaying 41 peptides derived from a peptide scan through Small t antigen of BK polyomavirus. Incubation with 20 samples (and one control) in parallel using the Array Slide 24-4 chamber. Protein name: Small T antigen. Specification: Peptide scan (15mers with 11 aa overlap). UniProt-ID: P03082. Sequence: MDKVLNREESMELMDLLGLERAAWGNLPLMRKAYLRKCKEFHPDKGGDEDKMKRMNTLYKKMEQDVKVAHQPDFGTWSSSEVCADFPLCPDTLYCKEWPICSKKPSVHCPCMLCQLRLRHLNRKFLRKEPLVWIDCYCIDCFTQWFGLDLTEETLQWWVQIIGETPFRDLKL. Protein Length: 172